Basic Information | |
---|---|
Taxon OID | 3300004758 Open in IMG/M |
Scaffold ID | Ga0068410_103184 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Formosa Ridge, offshore Taiwan - G2-3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1015 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Cold Seeps → Sediment → Marine Sediment → Metagenomics Analysis Of Sediments Collected From Formosa Ridge |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South China Sea, offshore SW Taiwan | |||||||
Coordinates | Lat. (o) | 22.10811667 | Long. (o) | 119.29126667 | Alt. (m) | Depth (m) | 1162 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021240 | Metagenome | 219 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068410_1031841 | F021240 | GGA | MLDFNNSKSRIEIIDQEDRALLRSNPSAWSMPEDGKEHIFYHMLLSSPSSFGSKAKNLLNWCEAPMKAKQAQSSAPVGHMSGLSIR |
⦗Top⦘ |