NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007797_1047506

Scaffold Ga0007797_1047506


Overview

Basic Information
Taxon OID3300004771 Open in IMG/M
Scaffold IDGa0007797_1047506 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1154
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011281Metagenome / Metatranscriptome292Y
F020665Metagenome / Metatranscriptome222Y
F043281Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0007797_10475061F011281AGGAMNEFKQKVLTASVDRYVLTNTQCEMLRQDAEVIGMKRATVLKKDGTTRRSFARSCSSCWIPYAKHNNWIYNIMRELTDAINAE
Ga0007797_10475062F020665AGGAMKKKNRKITLVKTSEQTAVRVIVDIDDDLYEALAKAGRHHLAKDKMACFEYALNKALLELCQELK*
Ga0007797_10475064F043281N/AGILSMPPIGLHPNHFAEQTWLNVMAHLWNIPLTELDPSFNCMTSVESHFGLDRYKDAMIIHYAGQSNDLTRLSNQIEADEAKLVELGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.