NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007794_10030491

Scaffold Ga0007794_10030491


Overview

Basic Information
Taxon OID3300004774 Open in IMG/M
Scaffold IDGa0007794_10030491 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1609
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011151Metagenome / Metatranscriptome294Y
F030431Metagenome / Metatranscriptome185N
F085161Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
Ga0007794_100304913F085161GGAGMEVYIVKSFGPENGWVNLKAFDNNDAAVYFANTVEKQIPDDIEDEFVEIEVLNVRSW*
Ga0007794_100304915F030431AGGAGMSDIEIEINELLDTTVMLCEDIAAQVGCPVEWVEKIVEKRWNDLLFSNDDFMNGYDMAKENM*
Ga0007794_100304917F011151GGAGMTGFQSKRQMAQDRFKVYCEWCHDWHYTDEVDILDVEEDIEGRDVAHFECGQPPSWNEDISRYDGTSSLVYKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.