Scaffold Ga0062380_10152938

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0062380_10152938

Scaffold Ga0062380_10152938

Overview

Basic Information
Taxon OID	3300004779 Open in IMG/M
Scaffold ID	Ga0062380_10152938 Open in IMG/M
Source Dataset Name	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	903
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment → Wetland Sediment Microbial Communities From St. Louis River Estuary, Michigan Under Dissolved Organic Matter Induced Mercury Methylation

Source Dataset Sampling Location
Location Name	USA: Michigan, St. Louis River estuary
Coordinates	Lat. (^o)	46.6972164	Long. (^o)	-92.3279105	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094298	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062380_101529382	F094298	GGAG	MTVDESVTVKGSPVRSLQKFVEANLTPAQRDSVLSTLPPQWAQRLRGPILPTETVPVYVLNKMTAEAAHAKGEPLEQFARRAGREAADDAVKGIYRFFALVLTPAALLSKASQMWISLYNRGELHVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.