Scaffold Ga0007741_1198159

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0007741_1198159

Scaffold Ga0007741_1198159

Overview

Basic Information
Taxon OID	3300004783 Open in IMG/M
Scaffold ID	Ga0007741_1198159 Open in IMG/M
Source Dataset Name	Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	560
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Michigan, USA
Coordinates	Lat. (^o)	43.1998	Long. (^o)	-86.5698	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019991	Metagenome / Metatranscriptome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007741_11981591	F019991	N/A	ELIQEKSQFIQANRPKVQQFFDHRSGVVKQQLEQARQNFTDKELANKAVFTELREKLSKDWKGANGSFVPGVPNIDLVSSDEYLLGLVRDGMKFREGPKVKNAGGSLAAASKPMARGKTAPEDKSVELQRKAQSGDKGAARDLLATMLASNRRRR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.