NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068459_101229

Scaffold Ga0068459_101229


Overview

Basic Information
Taxon OID3300004791 Open in IMG/M
Scaffold IDGa0068459_101229 Open in IMG/M
Source Dataset NamePorphyra umbilicalis microbial communities from the coast of Maine, USA, in Atlantic Ocean
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHudsonAlpha Institute for Biotechnology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15464
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Porphyra Umbilicalis → Porphyra Umbilicalis Symbiont Microbial Communities From The Coast Of Maine, Usa, In Atlantic Ocean

Source Dataset Sampling Location
Location NameTrenton, Maine, United States
CoordinatesLat. (o)44.4Long. (o)-68.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088156Metagenome109N

Sequences

Protein IDFamilyRBSSequence
Ga0068459_1012292F088156N/AMERASPDACLADNSLIPACGPCSVDLSDSPDLGASLFEVLGVKGLQRQSSCANWSFDEGCPESCFLHMAVFFSRFIGKVVPFSWCTNCQNMPALVSVHLIGPRDRHL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.