Scaffold Ga0068459_105274

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068459_105274

Scaffold Ga0068459_105274

Overview

Basic Information
Taxon OID	3300004791 Open in IMG/M
Scaffold ID	Ga0068459_105274 Open in IMG/M
Source Dataset Name	Porphyra umbilicalis microbial communities from the coast of Maine, USA, in Atlantic Ocean
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	HudsonAlpha Institute for Biotechnology
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4440
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (28.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Porphyra Umbilicalis → Porphyra Umbilicalis Symbiont Microbial Communities From The Coast Of Maine, Usa, In Atlantic Ocean

Source Dataset Sampling Location
Location Name	Trenton, Maine, United States
Coordinates	Lat. (^o)	44.4	Long. (^o)	-68.4	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013269	Metagenome	272	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068459_1052743	F013269	AGGAG	MVTDDAFLLPVNVNDERGGVRIDVNDHEGSNGFALQLVLPIVIGRVYMVADLDVRIAGCYPVIEVTFVTLLRLTQGLNDNRDLPAKACHEFAFAG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.