Basic Information | |
---|---|
Taxon OID | 3300004803 Open in IMG/M |
Scaffold ID | Ga0058862_12450674 Open in IMG/M |
Source Dataset Name | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 531 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Kellogg Biological Station, Michigan, Usa For Expression Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kellogg Biological Station, Michigan, USA | |||||||
Coordinates | Lat. (o) | 42.3912 | Long. (o) | -85.383786 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051558 | Metagenome / Metatranscriptome | 144 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0058862_124506741 | F051558 | N/A | LKKVDVPRTSSRDRDFIGGREFLEPSMSRKAEIKASLRGIARALHNFMGTASEERLPEKLVTLSERLTKSSHQDDPRIEPAIGRVQMSQKLAKSAAELESMIIAELREHPECDSAAVEVTSKEIGWDAILVRAGTQLNDPCEAMLVEITERLRREFDLSA* |
⦗Top⦘ |