Scaffold Ga0070913_100054

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0070913_100054

Scaffold Ga0070913_100054

Overview

Basic Information
Taxon OID	3300004822 Open in IMG/M
Scaffold ID	Ga0070913_100054 Open in IMG/M
Source Dataset Name	Hypersaline lake viral communities from Bras del Port, Santa Pola, Alicante, Spain - CR30 Febr14 dirigido
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2619
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Hypersaline Lake → Hypersaline Lake Viral Communities From Bras Del Port, Santa Pola, Alicante, Spain

Source Dataset Sampling Location
Location Name	Bras del Port, Alicante.
Coordinates	Lat. (^o)	38.19317	Long. (^o)	-0.59268	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065465	Metagenome	127	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070913_1000542	F065465	AGGA	MSEDITVVCECDATEEARSMGYRRYADMDAAMIVAAWPVHYTEHGSWDSHILPTLRCLAGYGDSGYGTYQQRQDVALIQDGDEADTPADAIILDSGHLLDDIIVSWQDGAHTAVTDTLRQSDEHSLEDIQR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.