Scaffold Ga0069134_109591

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0069134_109591

Scaffold Ga0069134_109591

Overview

Basic Information
Taxon OID	3300004831 Open in IMG/M
Scaffold ID	Ga0069134_109591 Open in IMG/M
Source Dataset Name	Marine surface microbial communities from the North Atlantic Ocean - filtered matter
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1349
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater → Marine Surface Microbial Communities From The North Atlantic Ocean, Enriched With Methanesulfonate

Source Dataset Sampling Location
Location Name	Leca da Palmeira, Matosinhos
Coordinates	Lat. (^o)	41.226956	Long. (^o)	-8.720528	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030892	Metagenome	184	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0069134_1095912	F030892	AGG	MENLVHSISETRMERLLNPKMSDHFYTNFVGKYGYRGYEIKVGRKWVTMRSNAHKVRMPLAKFKVHAFLQWRRDSMTDASCKVYNETGKYSRPRAWWKDYGFTSNPKDFNYEPSRLAW*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.