NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0007759_10117793

Scaffold Ga0007759_10117793


Overview

Basic Information
Taxon OID3300004836 Open in IMG/M
Scaffold IDGa0007759_10117793 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1678
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameLake Michigan, USA
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F000980Metagenome / Metatranscriptome814Y

Sequences

Protein IDFamilyRBSSequence
Ga0007759_101177931F000980N/ATCKDGYGWPNGVIDLTCPCNSKCTLLSVEDATIPYTDTPLTKEEPMETETPAVIVPDTYNSNLLVTYKVIHGYSDAEYTTDKVTSIEWDLHNGRQSQKQANMYASKIDTVKDIITEAYADSDDQETLRAIAEALDIELTRTVEWTASIEVSGTIELDLLAGYDTDIESEITDAIYAESQNGNIEITDQEVCNVSEC*
Ga0007759_101177935F000450AGGCGGMGDRANFGFVQPNGHTIVLYGHWAGHNMLANLAEAVFKARPRWNDASYATRIAISQMVADDWNSETGWGLSVNLINDNEHKIAIVDFKQQTFSLHEEAPHNDLDNKVRGMSNEPIFTMDLSNFVEKYADAIVSV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.