NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068517_1017939

Scaffold Ga0068517_1017939


Overview

Basic Information
Taxon OID3300004901 Open in IMG/M
Scaffold IDGa0068517_1017939 Open in IMG/M
Source Dataset NameWastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-EVs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)753
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Chromobacteriaceae → Laribacter → Laribacter hongkongensis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameNanji, South Korea
CoordinatesLat. (o)37.3132Long. (o)126.828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087089Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0068517_10179391F087089N/ALIPSTGGTKSGWQEKAIKWQTANKLALDEFPNLRAAITDSIKKSKTVDDMAARFKADTENMLKGGGRIFDNLKDPSAVIDTFIASKSRLADSQFIVKMAQDSPQFKTSLRGALAEKVAGLNNAKMIEFIENKANRELIKGIFGDTVLKKFDRVLVDAKRDRLGSTLGGVGGSQTYGRGATDKIMSQSIWKLDGAGASLGALLGTMLGGVGTMGGALGGAATAHTVKVLNMKQNALTSKAMLDPKYAAELLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.