NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068513_1000428

Scaffold Ga0068513_1000428


Overview

Basic Information
Taxon OID3300004951 Open in IMG/M
Scaffold IDGa0068513_1000428 Open in IMG/M
Source Dataset NameMarine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4275
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location NameEast Sea, Korea
CoordinatesLat. (o)37.0Long. (o)131.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025485Metagenome / Metatranscriptome201Y
F031456Metagenome / Metatranscriptome182Y
F051709Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0068513_10004283F025485N/AMENVRKYLPLIVGGIVAVAFFFISRKVRQSSGNSQERSEILEKAREAKLAKSILKKSENEESSSNIES*
Ga0068513_10004286F031456N/AMALIGSFPASASAVFNLDFLPERFLVTGPTQDNQALSNFSVVCSGTQLMSITDVNRLTALAKFDSGASLSDPSAANQSITVQWIRLATGRINKATTITGTNSVASARNAFAASTNIGNVARRAVEQSINPSANATFDNFEGLFFDPTNVLRAQVTFANGYTDEYTPEELRALYGAYHIADTGATLEGLVTIDADSGAGLISQVVIFAGSGAAVVVLKTDYVQL*
Ga0068513_10004288F051709N/AMIPNKERLGLEVAIRPHIKTIDVIKSELQKVNGSIERKWRQLDDFSASWSYTIWSNWKDSMAGELSYREYLLIMVEVYQK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.