NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0071328_158772

Scaffold Ga0071328_158772


Overview

Basic Information
Taxon OID3300005045 Open in IMG/M
Scaffold IDGa0071328_158772 Open in IMG/M
Source Dataset NamePermafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Chicago
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25945
Total Scaffold Genes50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)33 (66.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Fox Tunnel, Fairbanks, Alaska, Usa

Source Dataset Sampling Location
Location NameFairbanks, Alaska, USA
CoordinatesLat. (o)64.953Long. (o)-147.615Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082643Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0071328_15877228F082643GAGMQYPYQNLLIATNQNTISLDANVQMVVNAINTNSVIPYGDYGGPNVYYFQTLNNGLGNLIYTMFDRETNLGLASFMVRYGAATTIRMAVLQPFPRSQIDLQYLILPNIPITNTENGTVTP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.