Scaffold Ga0068302_10004065

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068302_10004065

Scaffold Ga0068302_10004065

Overview

Basic Information
Taxon OID	3300005071 Open in IMG/M
Scaffold ID	Ga0068302_10004065 Open in IMG/M
Source Dataset Name	Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	625
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Porotermes Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location Name	Mount Glorious, Queensland, Australia
Coordinates	Lat. (^o)	-27.330504	Long. (^o)	152.763993	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077443	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068302_100040651	F077443	N/A	MDLREIGCEDGRWMELAQDRVQRQALVLAVLSLRVLVPWI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.