NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070923_1739175

Scaffold Ga0070923_1739175


Overview

Basic Information
Taxon OID3300005072 Open in IMG/M
Scaffold IDGa0070923_1739175 Open in IMG/M
Source Dataset NameCompost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 64 soap2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCenter for Advanced Technologies in Genomics, Sao Paulo University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)512
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047639Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0070923_17391751F047639N/ASSTITYHLSSKFTPNFLINPDHIFIYNGYRTVIITDKSAETINPLDFESKFNAKDFETAIESKLIRDTFNTLKPKLFDMTTILLLLNLVMTFGVFYFLLKSQGVI*YERYKKR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.