Scaffold Ga0071347_1042394

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071347_1042394

Scaffold Ga0071347_1042394

Overview

Basic Information
Taxon OID	3300005073 Open in IMG/M
Scaffold ID	Ga0071347_1042394 Open in IMG/M
Source Dataset Name	Cellulose enrichment metagenome from thermal spring in Terrace, British Columbia, Canada
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Leibniz Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	928
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG03_land_8_20_14_0_80_45_14	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Sediment → Cellulose Enrichment Metagenome From Thermal Spring In Terrace, British Columbia, Canada

Source Dataset Sampling Location
Location Name	Terrace, B.C. Canada
Coordinates	Lat. (^o)	54.358506	Long. (^o)	-128.541159	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102093	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071347_10423942	F102093	N/A	VFIRLSIRQNEVSILPAKEQRKIMKHGTSGVVAIPKAYRDYHKLDPGSVVTVLYDSLLLIVPKGRENLLQEKAELIDQLLGQSKQVTRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.