 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300005079 Open in IMG/M |
| Scaffold ID | Ga0068304_1134108 Open in IMG/M |
| Source Dataset Name | Mastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Queensland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3154 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Townsville, Australia | |||||||
| Coordinates | Lat. (o) | -19.280075 | Long. (o) | 146.824457 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037785 | Metagenome | 167 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068304_11341084 | F037785 | AGGTGG | MARMEEGRGVYGVLVGGTKGKRPLGWRRRRREDNIRWTLRR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |