NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072336_10488153

Scaffold Ga0072336_10488153


Overview

Basic Information
Taxon OID3300005082 Open in IMG/M
Scaffold IDGa0072336_10488153 Open in IMG/M
Source Dataset NameMicrobial Community from Halfdan Field MHDA9
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → Idiomarina → unclassified Idiomarina → Idiomarina sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameNorth Sea, Denmark
CoordinatesLat. (o)55.49Long. (o)7.42Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053264Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0072336_104881531F053264N/ATNRLKLVGSPSVEQLQNGRYKLTVTCSTMNSREDWYSANKARIFPDFGSLQSAEMSIDGLAPRTGEAYADMRLTQVESGNRSNRDGGDYIVVLTYETLGSAFVQVKDDDTDYELNGLRRVTRTSIAEAGTDYDKTVGTSFIDHQIDAETAVRCFLASYAIDDTDSF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.