Basic Information | |
---|---|
Taxon OID | 3300005082 Open in IMG/M |
Scaffold ID | Ga0072336_10528473 Open in IMG/M |
Source Dataset Name | Microbial Community from Halfdan Field MHDA9 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 500 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Sea, Denmark | |||||||
Coordinates | Lat. (o) | 55.49 | Long. (o) | 7.42 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F098159 | Metagenome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072336_105284731 | F098159 | N/A | VELSKEFEVWARVKNTGTAAGEIKLCADIVFTDGAVAKCFCNKTVTVNPGQILDVMLCRLSFSVSGNFTVKVGNLSTTVTVKEAPVEVVEEDISILREGDTFYRVISNTVDVKPGEKISLRYWVEFNRIVDAEAWITINGQTVAKNRKKDVLLKVEVTDIVAQAPM |
⦗Top⦘ |