Scaffold Ga0062594_102358973

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0062594_102358973

Scaffold Ga0062594_102358973

Overview

Basic Information
Taxon OID	3300005093 Open in IMG/M
Scaffold ID	Ga0062594_102358973 Open in IMG/M
Source Dataset Name	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	580
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Microbulbiferaceae → Microbulbifer → Microbulbifer thermotolerans	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	42.4	Long. (^o)	-85.37	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029473	Metagenome / Metatranscriptome	188	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062594_1023589731	F029473	N/A	GNVIAIDTPDSRKPTPAPDGPPSPRLQDYLKSHKTRVEAPPSGPKGGPEASGPSFGTVDANLQTAFAQVFDGAGITQYKLTNFRGKTGVLVTTNTEEAVFNAINATARALSNPTSRGVPTTVTIVMTSSSGDAAGTVEMSPEQARQLVNGQVSAADFFVRNVAL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.