NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072683_100883

Scaffold Ga0072683_100883


Overview

Basic Information
Taxon OID3300005098 Open in IMG/M
Scaffold IDGa0072683_100883 Open in IMG/M
Source Dataset NameHydrothermal sediment microbial communities from the Guaymas Basin, Gulf of California, Pacific Ocean - 8, 4-6cmbsf
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10714
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (16.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Sediment In Guaymas

Source Dataset Sampling Location
Location NameGuaymas Basin
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093028Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0072683_1008835F093028N/AMNLEEYKKWKAPKELTLPSGFTIKVRDLSPWDLLVAASKQKEYKPNDPALIKELMQKFVVWPKIGKDWEIEDIRPDDYIFLQNKLFESFSLERFDNAIRAVEKIAEDNKDFSE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.