Basic Information | |
---|---|
Taxon OID | 3300005099 Open in IMG/M |
Scaffold ID | Ga0072682_102198 Open in IMG/M |
Source Dataset Name | Hydrothermal sediment microbial communities from the Guaymas Basin, Gulf of California, Pacific Ocean - 10, 8-11cmbsf |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7688 |
Total Scaffold Genes | 19 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 17 (89.47%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Sediment In Guaymas |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guaymas Basin | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081982 | Metagenome | 113 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072682_10219817 | F081982 | AGGAG | MAENIFVGEFRVIHTDANDNTVADLISKRSEEFGIVNKGSGTVAEFERDLQRLPKIPKIQDILREDDKLVIRVKPDNDTVVDVDDQDRYILIPVTVRNVRTNVVYPRILAYVDFTDLIEDDMTMKGGKWYNWLEYIIPAQTEIKLGVTMPDVRTASALSLQWDCNITT* |
⦗Top⦘ |