Basic Information | |
---|---|
Taxon OID | 3300005099 Open in IMG/M |
Scaffold ID | Ga0072682_116500 Open in IMG/M |
Source Dataset Name | Hydrothermal sediment microbial communities from the Guaymas Basin, Gulf of California, Pacific Ocean - 10, 8-11cmbsf |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Genomics Institute (BGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3304 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota → Thermococci → unclassified Thermococci → Thermococci archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Sediment In Guaymas |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guaymas Basin | |||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026175 | Metagenome | 198 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072682_1165004 | F026175 | GGAG | MALQSIKILNTAKENITKLLTGLGGYHYAAIGVGNDATAADETQQHLLGNEVSFKDGNQSVFQNANNSYIAQWNSTWVYNDLPSNQISEAAVAQNATNGTVNCLLRCTFDTIYLDADSSFSLILQVSPTQA* |
⦗Top⦘ |