Scaffold Ga0066818_1019820

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066818_1019820

Scaffold Ga0066818_1019820

Overview

Basic Information
Taxon OID	3300005104 Open in IMG/M
Scaffold ID	Ga0066818_1019820 Open in IMG/M
Source Dataset Name	Soil and rhizosphere microbial communities from Laval, Canada - mgHAC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	555
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location
Location Name	Laval, Canada
Coordinates	Lat. (^o)	45.54	Long. (^o)	-73.72	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090807	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066818_10198201	F090807	GGAGG	MTHKLTGREVYDALRELRQGHPGEYIAGSGTYIDGKVCIDTLALRLNEIIVAHGNHDAVMRAVTGED*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.