NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0069000_10156078

Scaffold Ga0069000_10156078


Overview

Basic Information
Taxon OID3300005182 Open in IMG/M
Scaffold IDGa0069000_10156078 Open in IMG/M
Source Dataset NameWetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordA_D2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)599
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: San Francisco Bay, California
CoordinatesLat. (o)38.15012Long. (o)-122.438774Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066824Metagenome / Metatranscriptome126N
F084306Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0069000_101560781F084306GGAGGMSKALLDKLSQKRNLEAQWASEFIANGSVTVKMVELKKKINQIAQELKDDSEKK*
Ga0069000_101560782F066824N/AMLVHFKFYRCGYFAEGLVEKDNLDDAAEALWKEHPKTFKWTDIQGPDNENRLTLEEWNEQGSTRQVESEAKPRSPVG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.