Scaffold Ga0072940_1211266

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0072940_1211266

Scaffold Ga0072940_1211266

Overview

Basic Information
Taxon OID	3300005200 Open in IMG/M
Scaffold ID	Ga0072940_1211266 Open in IMG/M
Source Dataset Name	Nasutitermes gut metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	756
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location Name	Murphy's Creek, Queensland, Australia
Coordinates	Lat. (^o)	-27.45	Long. (^o)	152.04	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071357	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072940_12112662	F071357	GAG	LAVRKQTTQKSDGERFNIRELNKLEVRKQYQIEITNRLAALENLIDK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.