Basic Information | |
---|---|
Taxon OID | 3300005201 Open in IMG/M |
Scaffold ID | Ga0072941_1047669 Open in IMG/M |
Source Dataset Name | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Queensland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3008 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Psylloidea → Psyllidae → Psyllinae → Cacopsylla → Cacopsylla melanoneura | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Indooroopilly, Australia | |||||||
Coordinates | Lat. (o) | -27.5 | Long. (o) | 152.9 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000286 | Metagenome | 1371 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0072941_10476691 | F000286 | N/A | YGKLYATTRRGRPRMRWLDDVSIDLRKMGVNKWRDRARNREAWRHIVEEAKAHPGL* |
⦗Top⦘ |