NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0072941_1242576

Scaffold Ga0072941_1242576


Overview

Basic Information
Taxon OID3300005201 Open in IMG/M
Scaffold IDGa0072941_1242576 Open in IMG/M
Source Dataset NameMicrocerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1108
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location NameIndooroopilly, Australia
CoordinatesLat. (o)-27.5Long. (o)152.9Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020929Metagenome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0072941_12425762F020929N/ARAETLHLDNKNQSVYGVSGTSRCLFSDKYKTHKYSVDRAYSC*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.