Basic Information | |
---|---|
Taxon OID | 3300005223 Open in IMG/M |
Scaffold ID | Ga0073350_110471 Open in IMG/M |
Source Dataset Name | Sylvan Springs Unknown 12.1A - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Stanford University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 949 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.699217 | Long. (o) | -110.767467 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F094112 | Metagenome / Metatranscriptome | 106 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073350_1104712 | F094112 | GAG | MSQSNIAVYNRGYNTITITDPTTGKTSVNLGLTTYNYPILAIHIYINNTSNPASGYVKAVITPLDELVTGYTGYSPTIEYFIDAYKGAMYIPLAPHEYVNITISISAGANLLYDAFLYDWMGER* |
⦗Top⦘ |