Scaffold Ga0073350_138755

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073350_138755

Scaffold Ga0073350_138755

Overview

Basic Information
Taxon OID	3300005223 Open in IMG/M
Scaffold ID	Ga0073350_138755 Open in IMG/M
Source Dataset Name	Sylvan Springs Unknown 12.1A - Microbial communities from the Yellowstone National Park, bulk metagenomes as controls for mini-metagenomic methods
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Stanford University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5612
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hotspring → Microbial Communities From The Yellowstone National Park, Bulk Metagenomes As Controls For Mini-Metagenomic Methods

Source Dataset Sampling Location
Location Name	Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.699217	Long. (^o)	-110.767467	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076261	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073350_1387558	F076261	AGGGGG	LARMIGSIAFQLGNATNSSQIVSSALSYFDPFFTAIMLFLGIAFWASLLFLIYYGIEAFAHPTPFGRSARLASMYDHVKSVVWSIIAIYLVVAVIAFAVNQASAAAGAGTTVNAGQLFYYIFVEPIVTGFKLFFGVTK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.