NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068637_1112381

Scaffold Ga0068637_1112381


Overview

Basic Information
Taxon OID3300005247 Open in IMG/M
Scaffold IDGa0068637_1112381 Open in IMG/M
Source Dataset NameAnoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)671
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming: Yellowstone National Park
CoordinatesLat. (o)44.539Long. (o)-110.798Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011940Metagenome / Metatranscriptome285Y
F060638Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0068637_11123811F060638AGGAGMDWLEDFWSKIVGWWDHASANVYNGIVAFINSLVEIWNGWMDALLHPAQAMPSVPALRWIVDWLGGIVDYTRLMYMLVDYVAYA
Ga0068637_11123812F011940N/ATLTPSPTWTALPSATRDPYQPPSAVPRYTLAPVTPPPLGDDVSWNGSLVGDLMDGLEALGRAVAPSAGRICDLPVPVLADAPEYGFKDALPDFVAGLCGFFGVASPVLNFVRLPVTLMVVGFVFWTAWRVFRSLS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.