NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074075_14522

Scaffold Ga0074075_14522


Overview

Basic Information
Taxon OID3300005256 Open in IMG/M
Scaffold IDGa0074075_14522 Open in IMG/M
Source Dataset NameHot spring microbial communities from Beowulf Spring, Yellowstone National Park, Wyoming, USA - YNP_Beowulf Spring_E
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1521
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameNorris Geyser Basin, Yellowstone National Park
CoordinatesLat. (o)44.733Long. (o)-110.708917Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006070Metagenome / Metatranscriptome382N

Sequences

Protein IDFamilyRBSSequence
Ga0074075_145222F006070AGGMTLYPYLVVDLPITDTNTHTYRTNPFNPLTPTQPGISLIRLGESVPPVRAFNIYVYNYANAALNVQVIANENAKNYQYGALLDGLDYQSESGYPDFNVGSAVAVPAGSLSTPSVQAIQSDFYKDAAERYLSVALTYSATPTSGFVRAHIDLFYEGF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.