Scaffold Ga0074071_1000431

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074071_1000431

Scaffold Ga0074071_1000431

Overview

Basic Information
Taxon OID	3300005258 Open in IMG/M
Scaffold ID	Ga0074071_1000431 Open in IMG/M
Source Dataset Name	Microbial communities on the surface of bentonite enhanced biochar
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Australian Centre for Ecogenomics
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15234
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (35.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Microbial Communities On The Surface Of Bentonite Enhanced Biochar

Source Dataset Sampling Location
Location Name	Sydney
Coordinates	Lat. (^o)	-33.917926	Long. (^o)	151.235347	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021141	Metagenome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074071_100043113	F021141	N/A	MSEPNVLVNFRLDKEAPLRFRWLATDGVPGDGYKAQVTAIKLAGGAVLEMDGSSIVEQTAPDAAGGLGAYMLTFSGMIGYASDHPNRKQIDKLEDQQVEYDLVFVHDDSERIAVENEDYKIIERPRGWLRKLSK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.