Scaffold Ga0073580_129737

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0073580_129737

Scaffold Ga0073580_129737

Overview

Basic Information
Taxon OID	3300005265 Open in IMG/M
Scaffold ID	Ga0073580_129737 Open in IMG/M
Source Dataset Name	Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4484. Combined assembly of Gp0115313 and Gp0146561
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6773
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (81.25%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Hydrothermal Sediment Microbial Communities From Guaymas Basin, California, Usa

Source Dataset Sampling Location
Location Name	Guaymus Basin
Coordinates	Lat. (^o)	27.013056	Long. (^o)	-111.519722	Alt. (m)		Depth (m)	0 to .01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057026	Metagenome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073580_1297371	F057026	GAG	MGGDEQILILEEMMCLFEKAMEGLKSAYERIEDEKLKLKLTGGILVFEFVINLMKQKMELLENEKKNRTYLIGVL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.