NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073580_130421

Scaffold Ga0073580_130421


Overview

Basic Information
Taxon OID3300005265 Open in IMG/M
Scaffold IDGa0073580_130421 Open in IMG/M
Source Dataset NameHydrothermal sediment microbial communities from Guaymas Basin, California, USA 4484. Combined assembly of Gp0115313 and Gp0146561
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Texas, Austin
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9359
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Hydrothermal Sediment Microbial Communities From Guaymas Basin, California, Usa

Source Dataset Sampling Location
Location NameGuaymus Basin
CoordinatesLat. (o)27.013056Long. (o)-111.519722Alt. (m)Depth (m)0 to .01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055333Metagenome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0073580_13042122F055333GGAGGMGDDLQHKRAVKVCLSGRNTGMGAYTEWTVYSTRQRKRLKPHRTEYSRTGNHWWHYFFLLPGKYLAAVKDISNSGKHYCRYCLIRVFTQEEFREMHKNDERVMQNFDHYYRHNAYEIIDLPCVRRWSGEVVKVIKNGGSRIA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.