NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0065705_10106452

Scaffold Ga0065705_10106452


Overview

Basic Information
Taxon OID3300005294 Open in IMG/M
Scaffold IDGa0065705_10106452 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)6613
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Michigan, Usa

Source Dataset Sampling Location
Location NameEast Lansing, MI
CoordinatesLat. (o)42.794771Long. (o)-84.393804Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005575Metagenome / Metatranscriptome396Y
F005718Metagenome / Metatranscriptome392Y
F037459Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0065705_101064527F005718GGCGGMAKRKKRVAIKNRKLGISISCRVQKPVLKDLDAYRKLLKLSRPDALVKLATDHLAGLKEPAEKMWEGAVERMFPATNGDKGDDPR*
Ga0065705_101064528F037459GGAGMVTPYRPKPPRNRVAISTRDLARRMRKSLNKTTEGIEAAVAKVKNNGETAIKESEAKRT*
Ga0065705_101064529F005575N/AITTWSVEPTVGKTPTISVNPLGLMTTTTNLPQAHYQDFSTIY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.