Scaffold Ga0071330_1069753

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071330_1069753

Scaffold Ga0071330_1069753

Overview

Basic Information
Taxon OID	3300005298 Open in IMG/M
Scaffold ID	Ga0071330_1069753 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial communities from Great Boiling Spring, Nevada - Cellulolytic enrichment Sediment 77C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7321
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada

Source Dataset Sampling Location
Location Name	Great Boiling Spring, Nevada
Coordinates	Lat. (^o)	40.71458	Long. (^o)	-119.369659	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027047	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071330_10697531	F027047	GAGG	MDLSSLGIAVLSAVVYSLSMYVKKHLNTDNPQSFDATKFLTTLIWGIIVGVILQFSGVPITEQSVEEQFIAYAGLIAITENIIKAIIRAVDR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.