NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070683_100233775

Scaffold Ga0070683_100233775


Overview

Basic Information
Taxon OID3300005329 Open in IMG/M
Scaffold IDGa0070683_100233775 Open in IMG/M
Source Dataset NameCorn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1747
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan, Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008060Metagenome / Metatranscriptome340Y
F052754Metagenome142Y
F055137Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
Ga0070683_1002337751F055137N/ASPSTQRGGAREVNKPISRLQSPDPQLATSPQVFINPAAFAIGPVGDRERCLPPLGVKLSAIVPADPGTAPGLYMGSLGLPPDSAVSGGLAQPPEVTQYGSICTTMIDWVAEGALDPLRSLNVPFGPVTALAFTSLTDSRAVLAIADDPTLVVPDQTLQKSQLVPPTTGQHGQGHVFIVP*
Ga0070683_1002337752F052754N/AMRFIFLAITFLCGLLLFAKETPKAMLVVHNDIKGPIIGNMHTEDFAIFADGRVRYSEAGNDRKTATVNFRLTPAQLHRLTALLNSKEMRAVPAEIPSQIKVVDFDWEAQLKIQHPSGRQTIAIKNFYPMMNTQRPTYPKALIEVECMLRDIQARATKRPVHTEDEDWCPEKAQ*
Ga0070683_1002337753F008060GAGGMAIPDVTQKSFIYHTLSELNTAFAAIVGHCETLQQTGLFKSKAAKLFSSFTQELQAEMNQEFLEDLHQLELDDWNGYGRARQKWEKYLKDPDDVFIHAEERRKELARQRKKH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.