Basic Information | |
---|---|
Taxon OID | 3300005346 Open in IMG/M |
Scaffold ID | Ga0074242_10457888 Open in IMG/M |
Source Dataset Name | Saline sediment microbial community from Etoliko Lagoon, Greece |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3591 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (10.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Etoliko Lagoon, Greece | |||||||
Coordinates | Lat. (o) | 38.482158 | Long. (o) | 21.313175 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F020161 | Metagenome / Metatranscriptome | 225 | Y |
F073444 | Metagenome / Metatranscriptome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074242_104578885 | F073444 | N/A | MQSKILNCKIEMNELEIDMLKDGNEVLPYNVGRADELETKKLKLLLGKRFHQNASNAYWYYMAKQGK* |
Ga0074242_104578887 | F020161 | N/A | MNTMLPWSALFLLLTPESQDVARAELEACANIRSEKVDRIYYAIAAHEDALERIKKESELVTQAKRRHESQLKSLKSLLSWLRRSLPGDNNKITGKNYQFTLSKKKDLTVEITSDPELWDTEERLFYCIEEEVCTTKRIVLRSLSGEVLEERTEP* |
⦗Top⦘ |