 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300005346 Open in IMG/M |
| Scaffold ID | Ga0074242_10769882 Open in IMG/M |
| Source Dataset Name | Saline sediment microbial community from Etoliko Lagoon, Greece |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 686 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Etoliko Lagoon, Greece | |||||||
| Coordinates | Lat. (o) | 38.482158 | Long. (o) | 21.313175 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084173 | Metagenome | 112 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074242_107698821 | F084173 | GGAGG | MSQQYALTKDWWTVHTGNDESSIVYGSRGESKRVSTPHTSFAEFDTEEELATYLGELTGVSTWYADQQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |