NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068884_1133491

Scaffold Ga0068884_1133491


Overview

Basic Information
Taxon OID3300005417 Open in IMG/M
Scaffold IDGa0068884_1133491 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22884
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (96.15%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Lake Erie, Under A Cyanobacterial Bloom.

Source Dataset Sampling Location
Location NameUSA: Ohio, Lake Erie
CoordinatesLat. (o)41.69957Long. (o)-83.2941Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024819Metagenome / Metatranscriptome204Y
F033006Metagenome / Metatranscriptome178Y
F068608Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0068884_113349121F033006GAGGMRWQENTFFDHLDKFGNSLGYDNFGVAFMLSMVPWESPTDRDNFIREITGQDVKGGEPTRFNQDYVEF*
Ga0068884_113349122F068608AGGAGMARGGANGGPQYNPANVSATGGAGQSGKFVAEKVAKATQLRPSGFPQGENKALAEQMSAGGNVASTASAANPTPETPAAPAMGGLAELMSQVQPLDAEPTEYLPISDGVDFGAGRGSEALPPRFQQDNRTIENVDLVKRYMPDLLNAARMPGAPDSYKRMINALLREVM*
Ga0068884_113349123F024819AGGAGGVSKFTEAMNKALQVLAEELEDSENQICTGWVLVSEWSDFEGTRYLMTDVSENMNPWLAKGMLISAEEYSYVPEEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.