NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070709_10001811

Scaffold Ga0070709_10001811


Overview

Basic Information
Taxon OID3300005434 Open in IMG/M
Scaffold IDGa0070709_10001811 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11582
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004077Metagenome / Metatranscriptome454Y
F008442Metagenome / Metatranscriptome333Y
F056105Metagenome / Metatranscriptome138N
F061022Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0070709_1000181112F004077GGAMFFRSLFYERTILGHLERVEQLPAEVQTEIAMRVRNLIELARPVGDALLERFAEIARQEQLLAVKDGAKSDTDPQWAAPAISGAWCNARLGLAKGSLNRHSAVAIIAAVETFTKKKALDRQRRA*
Ga0070709_1000181113F061022GGAGGMTCGPKEYRAHAEFCLGRARTVRNPVLAEEFEKLAQSWLRLAKAAERDGVVAEPQPKKRDEFRA*
Ga0070709_1000181115F008442AGGMAAYEITQDQRAAYDLAIQAMRPLHGTATLVKVNDIRGHAAVLALFDEVIAAG*
Ga0070709_1000181116F056105N/APRAERRELLSAALTHLEAVAKLLEEAEEEVLADEARELTDKVDVVALAEAA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.