NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070713_101168681

Scaffold Ga0070713_101168681


Overview

Basic Information
Taxon OID3300005436 Open in IMG/M
Scaffold IDGa0070713_101168681 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)744
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.4774Long. (o)-85.451Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000334Metagenome / Metatranscriptome1279Y
F009911Metagenome / Metatranscriptome311Y

Sequences

Protein IDFamilyRBSSequence
Ga0070713_1011686811F009911AGGAGGMTAISIDGMGLTGVLRLTWVQDELAHVLDHSHTDETSGTWTGLACPDHGLALGTDVDNATLRHLATGSEIADLTWEAPDELAAEHAQVFQDAM
Ga0070713_1011686812F000334N/AADWEAATRVQRQLAVAADAELRRRHPEQRFTPLRSAEPPSATPAQRDELTLTAGQPIPEMGQWVKDLAASHRVFARTLAERQSLMVPSEDPGYGDLGQAFPPWPGPARGAILQPPKPEIRPCPEVLQRAADRDADWEATD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.