NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070708_100007774

Scaffold Ga0070708_100007774


Overview

Basic Information
Taxon OID3300005445 Open in IMG/M
Scaffold IDGa0070708_100007774 Open in IMG/M
Source Dataset NameCorn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8591
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (52.94%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameUSA: Michigan: Kellogg Biological Station
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020759Metagenome / Metatranscriptome222Y
F043561Metagenome / Metatranscriptome156Y
F060797Metagenome132Y

Sequences

Protein IDFamilyRBSSequence
Ga0070708_10000777413F060797N/AMVKQKESVESLKGWSVIAKFLSQPVSTAQRWAREGMPVTRIGRYIAASPAELERWLTREAGTKETVHIASPTTDLLADLKRGLSQARKIPPKKSRS*
Ga0070708_1000077745F043561AGGAMNTATYKGLYTDSWKDLYQAAIRESDLTKLPERIADAETALVTRARDLFYTSGDKIEEEGSLDDAMCILHALRSSLKHRPTGIQRMADSDYLKRA*
Ga0070708_1000077749F020759N/AVWNYDANGNFLGTIKLSETLTLGQGGYTHSGSFTLDFYDPSGSFLIEAAGSVTGERISVE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.