Scaffold Ga0068706_1081458

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068706_1081458

Scaffold Ga0068706_1081458

Overview

Basic Information
Taxon OID	3300005452 Open in IMG/M
Scaffold ID	Ga0068706_1081458 Open in IMG/M
Source Dataset Name	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	566
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming: Yellowstone National Park
Coordinates	Lat. (^o)	44.963	Long. (^o)	-110.715	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057954	Metagenome / Metatranscriptome	135	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068706_10814581	F057954	N/A	GRGVIAIELDHTKGPSALLPPPMLPKTLTFSPSPDKTLLWYWVFGPVESGEGNKGVEIHGEKSYVPIDPDLVGEGFWRPPWPSWREVAPAPNWVYVPRRLRGVKRPFYWLENGKLAYADLDGRRDAHLWYKGVWRLGEAPLAILRFAIDRRLEGGYRWAVVSEALTLNAENCIPPLPEAEARAIAEWV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.