Basic Information | |
---|---|
Taxon OID | 3300005453 Open in IMG/M |
Scaffold ID | Ga0068705_10111083 Open in IMG/M |
Source Dataset Name | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 719 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic → Anoxygenic And Chlorotrophic Microbial Mat Microbial Communities From Yellowstone National Park, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming: Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.963 | Long. (o) | -110.715 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056129 | Metagenome | 138 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068705_101110832 | F056129 | GGAGG | MSYNGWPNHETWVMSLYCESHEDVLSLREYLEEIAAGLPLPAMDLLLSAVASVNWEYLERALSPTNAD* |
⦗Top⦘ |