NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074213_129910

Scaffold Ga0074213_129910


Overview

Basic Information
Taxon OID3300005488 Open in IMG/M
Scaffold IDGa0074213_129910 Open in IMG/M
Source Dataset NameSediment ecosystem from Lake Washington, Seattle, Washington, USA - Methane enrichment
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)868
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa

Source Dataset Sampling Location
Location NameLake Washington, Seattle, USA
CoordinatesLat. (o)47.63458Long. (o)-122.26655Alt. (m)Depth (m)63
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026032Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0074213_1299101F026032N/ARPKVQRSKGQRVNGSEDCQPMTDAPRLTVAFAMFVQGYDPERPTDLRQMTTGIGGWRAEAPPTVPLTLAIGLWNAGRGGRVACRLGVRRPGEDVQYIGEGDTTVTDPGELVVLPLKMTLTFDRPGTYWAIAEFDGQRLVEVPFLVSADAPPAFPDHSASSA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.