Scaffold Ga0074212_101972

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074212_101972

Scaffold Ga0074212_101972

Overview

Basic Information
Taxon OID	3300005491 Open in IMG/M
Scaffold ID	Ga0074212_101972 Open in IMG/M
Source Dataset Name	Sediment ecosystem from Lake Washington, Seattle, Washington, USA - Formaldehyde enrichment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	1200
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment → Sediment Methylotrophic Communities From Lake Washington, Seattle, Washington, Usa

Source Dataset Sampling Location
Location Name	Lake Washington, Seattle, Washington, USA
Coordinates	Lat. (^o)	47.63458	Long. (^o)	-122.26655	Alt. (m)		Depth (m)	63
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004137	Metagenome / Metatranscriptome	451	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074212_1019722	F004137	GGTGG	MTAGWILLGVVGWTLGVVFVLLLFRMAGDQDRAARHQQKRCFPTADVTITRMRG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.