NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068912_11134772

Scaffold Ga0068912_11134772


Overview

Basic Information
Taxon OID3300005506 Open in IMG/M
Scaffold IDGa0068912_11134772 Open in IMG/M
Source Dataset NameSoil microbial communities from Colorado Plateau, USA - Soil Crust after dry out 3A (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)510
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → Corallococcus → Corallococcus coralloides(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location
Location NameUSA: Colorado Plateau
CoordinatesLat. (o)38.42Long. (o)-109.4099Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013569Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
Ga0068912_111347721F013569GGAGMAKKLTLSKETLRTLDEKELSQIVGGAQSGSHVPPHGGPSCPNTKAPGCQQNNAP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.